PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0088s0056.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 229aa    MW: 25333.3 Da    PI: 8.7734
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0088s0056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.5e-33145203159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  Kaladp0088s0056.1.p 145 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGVVITTYEGVHSHP 203
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-33130203IPR003657WRKY domain
SuperFamilySSF1182901.96E-29137204IPR003657WRKY domain
PROSITE profilePS5081130.01140205IPR003657WRKY domain
SMARTSM007742.2E-39145204IPR003657WRKY domain
PfamPF031068.2E-27146203IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MFMAFDQISN SASSHFSLAS IMPMCSSSLR DSNQLFQSQK TTSLLAGLME MQQQGDVMKR  60
ISVEDIADGD KDSSNNNICY ENEGGGCIDD QSCNSAGMKQ LERHQKPNTA QSKGGGGGGG  120
GGAPAEKKIK KHRYAFQTRS HVDILDDGYR WRKYGQKAVK NNKFPRSYYR CTHQGCNVKK  180
QVQRLSKDEG VVITTYEGVH SHPIQKSTDN FEHILTQMQI YSNTSSTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-27135202774Probable WRKY transcription factor 4
1wj2_A3e-27135202774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222197.14e-66PREDICTED: probable WRKY transcription factor 75
TrEMBLM5XPE97e-65M5XPE9_PRUPE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.13e-58WRKY DNA-binding protein 75